![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
![]() | Protein automated matches [190753] (21 species) not a true protein |
![]() | Species Methanococcus jannaschii [TaxId:2190] [225207] (3 PDB entries) |
![]() | Domain d2j9dh_: 2j9d H: [204993] Other proteins in same PDB: d2j9da2, d2j9db2, d2j9dc2, d2j9dd2, d2j9df2, d2j9dg2, d2j9di2, d2j9dj2, d2j9dk2, d2j9dl2 automated match to d3ncrc_ complexed with act, adp, amp, cl |
PDB Entry: 2j9d (more details), 2.1 Å
SCOPe Domain Sequences for d2j9dh_:
Sequence, based on SEQRES records: (download)
>d2j9dh_ d.58.5.0 (H:) automated matches {Methanococcus jannaschii [TaxId: 2190]} gsmkkveaiirpekleivkkalsdagyvgmtvsevkgrgvqggiveryrgreyivdlipk vkielvvkeedvdnvidiicenartgnpgdgkifvipvervvrvrtkeegkeal
>d2j9dh_ d.58.5.0 (H:) automated matches {Methanococcus jannaschii [TaxId: 2190]} gsmkkveaiirpekleivkkalsdagyvgmtvsevkgrgvivdlipkvkielvvkeedvd nvidiicenartgnpgdgkifvipvervvrvrtkeegkeal
Timeline for d2j9dh_: