Lineage for d1dl7h_ (1dl7 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740504Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)
  8. 2740547Domain d1dl7h_: 1dl7 H: [20499]
    Other proteins in same PDB: d1dl7l_
    part of Fv M3C65; conflict: annotated in PDB as human protein
    complexed with nch

Details for d1dl7h_

PDB Entry: 1dl7 (more details), 2.35 Å

PDB Description: the structural basis of repertoire shift in an immune response to phosphocholine
PDB Compounds: (H:) protein (antibody m3c65 (heavy chain))

SCOPe Domain Sequences for d1dl7h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dl7h_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
qvqlkesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgstdyn
salksrlniskdksksqvflrmyslqtddtaryycardygpywgqgtlvtvs

SCOPe Domain Coordinates for d1dl7h_:

Click to download the PDB-style file with coordinates for d1dl7h_.
(The format of our PDB-style files is described here.)

Timeline for d1dl7h_: