Lineage for d2j9dc1 (2j9d C:-1-112)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950865Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2950866Protein automated matches [190753] (21 species)
    not a true protein
  7. 2950997Species Methanococcus jannaschii [TaxId:2190] [225207] (3 PDB entries)
  8. 2951006Domain d2j9dc1: 2j9d C:-1-112 [204988]
    Other proteins in same PDB: d2j9da2, d2j9db2, d2j9dc2, d2j9dd2, d2j9df2, d2j9dg2, d2j9di2, d2j9dj2, d2j9dk2, d2j9dl2
    automated match to d3ncrc_
    complexed with act, adp, amp, cl

Details for d2j9dc1

PDB Entry: 2j9d (more details), 2.1 Å

PDB Description: structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake
PDB Compounds: (C:) hypothetical nitrogen regulatory pii-like protein mj0059

SCOPe Domain Sequences for d2j9dc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j9dc1 d.58.5.0 (C:-1-112) automated matches {Methanococcus jannaschii [TaxId: 2190]}
gsmkkveaiirpekleivkkalsdagyvgmtvsevkgrgvqggiveryrgreyivdlipk
vkielvvkeedvdnvidiicenartgnpgdgkifvipvervvrvrtkeegkeal

SCOPe Domain Coordinates for d2j9dc1:

Click to download the PDB-style file with coordinates for d2j9dc1.
(The format of our PDB-style files is described here.)

Timeline for d2j9dc1: