Lineage for d2j90a1 (2j90 A:9-278)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (18 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (704 PDB entries)
  8. 2545332Domain d2j90a1: 2j90 A:9-278 [204981]
    Other proteins in same PDB: d2j90a2
    automated match to d2y4pc_
    complexed with cl, edo, iza, po4

Details for d2j90a1

PDB Entry: 2j90 (more details), 2 Å

PDB Description: crystal structure of human zip kinase in complex with a tetracyclic pyridone inhibitor (pyridone 6)
PDB Compounds: (A:) death-associated protein kinase 3

SCOPe Domain Sequences for d2j90a1:

Sequence, based on SEQRES records: (download)

>d2j90a1 d.144.1.7 (A:9-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vedhyemgeelgsgqfaivrkcrqkgtgkeyaakfikkrrlsssrrgvsreeierevnil
reirhpniitlhdifenktdvvlilelvsggelfdflaekesltedeatqflkqildgvh
ylhskriahfdlkpenimlldknvpnpriklidfgiahkieagnefknifgtpefvapei
vnyeplgleadmwsigvityillsgaspflgetkqetltnisavnydfdeeyfsntsela
kdfirrllvkdpkrrmtiaqslehswikai

Sequence, based on observed residues (ATOM records): (download)

>d2j90a1 d.144.1.7 (A:9-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vedhyemgeelgsgqfaivrkcrqkgtgkeyaakfikkrrlsssrrgvsreeierevnil
reirhpniitlhdifenktdvvlilelvsggelfdflaekesltedeatqflkqildgvh
ylhskriahfdlkpenimlldknvpnpriklidfgiahkiegtpefvapeivnyeplgle
admwsigvityillsgaspflgetkqetltnisavnydfdeeyfsntselakdfirrllv
kdpkrrmtiaqslehswikai

SCOPe Domain Coordinates for d2j90a1:

Click to download the PDB-style file with coordinates for d2j90a1.
(The format of our PDB-style files is described here.)

Timeline for d2j90a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j90a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2j90b_