SCOPe 2.06: Domain d2j6za_: 2j6z A:

Lineage for d2j6za_ (2j6z A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.186: KaiA/RbsU domain [101214] (1 superfamily)
   4 helices; bundle, right-handed twist; right-handed superhelix

4. Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families)

5. Family a.186.1.2: Phosphoserine phosphatase RsbU, N-terminal domain [109836] (2 proteins)
   forms a helix-swapped dimer that otherwise is similar to the KaiA domain dimer
   automatically mapped to Pfam PF08673

6. Protein automated matches [226930] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225224] (3 PDB entries)

8. Domain d2j6za_: 2j6z A: [204979]
   automated match to d1w53a_

Details for d2j6za_

PDB Entry: 2j6z, 1.95 Å

PDB Description: structural and functional characterisation of partner-switching regulating the environmental stress response in b. subtilis

PDB Compounds: (A:) phosphoserine phosphatase rsbu

SCOPe Domain Sequences for d2j6za_:

Sequence; same for both SEQRES and ATOM records:

>d2j6za_ a.186.1.2 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mdfrevieqryhqllsryiaeltetsliqaqkfsrktiehqippeeiisihrkvlkelyp
slpedvfhsldflievmigygmayqe

Timeline for d2j6za_:

• d2j6za_ first appeared in SCOPe 2.03
  
• d2j6za_ appears in SCOPe 2.05
  
• d2j6za_ appears in SCOPe 2.07
  
• d2j6za_ appears in the current release, SCOPe 2.08