Lineage for d2j6ye_ (2j6y E:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1507878Fold a.186: KaiA/RbsU domain [101214] (1 superfamily)
    4 helices; bundle, right-handed twist; right-handed superhelix
  4. 1507879Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families) (S)
  5. 1507897Family a.186.1.2: Phosphoserine phosphatase RsbU, N-terminal domain [109836] (2 proteins)
    forms a helix-swapped dimer that otherwise is similar to the KaiA domain dimer
    automatically mapped to Pfam PF08673
  6. 1507901Protein automated matches [226930] (1 species)
    not a true protein
  7. 1507902Species Bacillus subtilis [TaxId:1423] [225224] (3 PDB entries)
  8. 1507907Domain d2j6ye_: 2j6y E: [204978]
    automated match to d1w53a_

Details for d2j6ye_

PDB Entry: 2j6y (more details), 1.85 Å

PDB Description: structural and functional characterisation of partner switching regulating the environmental stress response in bacillus subtilis
PDB Compounds: (E:) phosphoserine phosphatase rsbu

SCOPe Domain Sequences for d2j6ye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6ye_ a.186.1.2 (E:) automated matches {Bacillus subtilis [TaxId: 1423]}
dfrevieqryhqllsryiaeltktslyqaqkfsrktiehqippeeiisihrkvlkelyps
lpedvfhsldflievmigygm

SCOPe Domain Coordinates for d2j6ye_:

Click to download the PDB-style file with coordinates for d2j6ye_.
(The format of our PDB-style files is described here.)

Timeline for d2j6ye_: