![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.186: KaiA/RbsU domain [101214] (1 superfamily) 4 helices; bundle, right-handed twist; right-handed superhelix |
![]() | Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families) ![]() |
![]() | Family a.186.1.2: Phosphoserine phosphatase RsbU, N-terminal domain [109836] (2 proteins) forms a helix-swapped dimer that otherwise is similar to the KaiA domain dimer automatically mapped to Pfam PF08673 |
![]() | Protein automated matches [226930] (1 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [225224] (3 PDB entries) |
![]() | Domain d2j6ya_: 2j6y A: [204974] automated match to d1w53a_ |
PDB Entry: 2j6y (more details), 1.85 Å
SCOPe Domain Sequences for d2j6ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j6ya_ a.186.1.2 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} mdfrevieqryhqllsryiaeltktslyqaqkfsrktiehqippeeiisihrkvlkelyp slpedvfhsldflievmigygmayq
Timeline for d2j6ya_:
![]() Domains from other chains: (mouse over for more information) d2j6yb_, d2j6yc_, d2j6yd_, d2j6ye_ |