Lineage for d2j6ya_ (2j6y A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736153Fold a.186: KaiA/RbsU domain [101214] (1 superfamily)
    4 helices; bundle, right-handed twist; right-handed superhelix
  4. 2736154Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families) (S)
  5. 2736172Family a.186.1.2: Phosphoserine phosphatase RsbU, N-terminal domain [109836] (2 proteins)
    forms a helix-swapped dimer that otherwise is similar to the KaiA domain dimer
    automatically mapped to Pfam PF08673
  6. 2736176Protein automated matches [226930] (1 species)
    not a true protein
  7. 2736177Species Bacillus subtilis [TaxId:1423] [225224] (3 PDB entries)
  8. 2736178Domain d2j6ya_: 2j6y A: [204974]
    automated match to d1w53a_

Details for d2j6ya_

PDB Entry: 2j6y (more details), 1.85 Å

PDB Description: structural and functional characterisation of partner switching regulating the environmental stress response in bacillus subtilis
PDB Compounds: (A:) phosphoserine phosphatase rsbu

SCOPe Domain Sequences for d2j6ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6ya_ a.186.1.2 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mdfrevieqryhqllsryiaeltktslyqaqkfsrktiehqippeeiisihrkvlkelyp
slpedvfhsldflievmigygmayq

SCOPe Domain Coordinates for d2j6ya_:

Click to download the PDB-style file with coordinates for d2j6ya_.
(The format of our PDB-style files is described here.)

Timeline for d2j6ya_: