Lineage for d1e6jh1 (1e6j H:1-120)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157802Species Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain [48909] (2 PDB entries)
  8. 157805Domain d1e6jh1: 1e6j H:1-120 [20497]
    Other proteins in same PDB: d1e6jh2, d1e6jl2, d1e6jp1, d1e6jp2

Details for d1e6jh1

PDB Entry: 1e6j (more details), 3 Å

PDB Description: crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5

SCOP Domain Sequences for d1e6jh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6jh1 b.1.1.1 (H:1-120) Immunoglobulin (variable domains of L and H chains) {Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain}
evqlqqsgaelarpgasvkmsckasgytftsytmhwvkqrpgqglewigyinpssgysny
nqkfkdkatltadkssstaymqlssltsedsavyycsrpvvrlgynfdywgqgstltvss

SCOP Domain Coordinates for d1e6jh1:

Click to download the PDB-style file with coordinates for d1e6jh1.
(The format of our PDB-style files is described here.)

Timeline for d1e6jh1: