Lineage for d2j6kc_ (2j6k C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783437Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)
  8. 2783547Domain d2j6kc_: 2j6k C: [204964]
    automated match to d3i35a_
    complexed with na

Details for d2j6kc_

PDB Entry: 2j6k (more details), 2.77 Å

PDB Description: n-terminal sh3 domain of cms (cd2ap human homolog)
PDB Compounds: (C:) CD2-associated protein

SCOPe Domain Sequences for d2j6kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6kc_ b.34.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik

SCOPe Domain Coordinates for d2j6kc_:

Click to download the PDB-style file with coordinates for d2j6kc_.
(The format of our PDB-style files is described here.)

Timeline for d2j6kc_: