Lineage for d2j67b_ (2j67 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856197Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families) (S)
  5. 2856198Family c.23.2.1: Toll/Interleukin receptor TIR domain [52201] (3 proteins)
    automatically mapped to Pfam PF01582
  6. 2856211Protein automated matches [226912] (1 species)
    not a true protein
  7. 2856212Species Human (Homo sapiens) [TaxId:9606] [225149] (2 PDB entries)
  8. 2856214Domain d2j67b_: 2j67 B: [204961]
    automated match to d1fyva_

Details for d2j67b_

PDB Entry: 2j67 (more details), 2.2 Å

PDB Description: the tir domain of human toll-like receptor 10 (tlr10)
PDB Compounds: (B:) toll like receptor 10

SCOPe Domain Sequences for d2j67b_:

Sequence, based on SEQRES records: (download)

>d2j67b_ c.23.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rnvrfhafisysehdslwvknelipnlekedgsiliclyesyfdpgksisenivsfieks
yksifvlspnfvqnewchyefyfahhnlfhensdhiilillepipfyciptryhklkall
ekkaylewpkdrrkcglfwanlraain

Sequence, based on observed residues (ATOM records): (download)

>d2j67b_ c.23.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rnvrfhafisysehdslwvknelipnlekedgsiliclyesyfdpgksisenivsfieks
yksifvlspnfvqnewchyefyfahhnlfhensdhiilillepipfyekkaylewpkdrr
kcglfwanlraain

SCOPe Domain Coordinates for d2j67b_:

Click to download the PDB-style file with coordinates for d2j67b_.
(The format of our PDB-style files is described here.)

Timeline for d2j67b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2j67a_