SCOPe 2.08: Domain d2j67a_: 2j67 A:

Lineage for d2j67a_ (2j67 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families)

5. Family c.23.2.1: Toll/Interleukin receptor TIR domain [52201] (3 proteins)
   automatically mapped to Pfam PF01582

6. Protein automated matches [226912] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225149] (2 PDB entries)

8. Domain d2j67a_: 2j67 A: [204960]
   automated match to d1fyva_

Details for d2j67a_

PDB Entry: 2j67, 2.2 Å

PDB Description: the tir domain of human toll-like receptor 10 (tlr10)

PDB Compounds: (A:) toll like receptor 10

SCOPe Domain Sequences for d2j67a_:

Sequence, based on SEQRES records:

>d2j67a_ c.23.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkrnvrfhafisysehdslwvknelipnlekedgsiliclyesyfdpgksisenivsfie
ksyksifvlspnfvqnewchyefyfahhnlfhensdhiilillepipfyciptryhklka
llekkaylewpkdrrkcglfwanlraain

Sequence, based on observed residues (ATOM records):

>d2j67a_ c.23.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkrnvrfhafisysehdslwvknelipnlekedsiliclyesyfdpgksisenivsfiek
syksifvlspnfvqnewchyefyfahhnhiilillepipfyciptryhklkallekkayl
ewpkdrrkcglfwanlraain

Timeline for d2j67a_:

• d2j67a_ first appeared in SCOPe 2.03
  
• d2j67a_ appears in SCOPe 2.07