Lineage for d1e6jl1 (1e6j L:1-105)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1756616Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1757204Species Mouse (Mus musculus), cluster 3.4 [TaxId:10090] [88530] (4 PDB entries)
  8. 1757208Domain d1e6jl1: 1e6j L:1-105 [20496]
    Other proteins in same PDB: d1e6jh1, d1e6jh2, d1e6jl2, d1e6jp1, d1e6jp2
    part of Fab 13B5 against HIV-1 capsid protein p24

Details for d1e6jl1

PDB Entry: 1e6j (more details), 3 Å

PDB Description: crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5
PDB Compounds: (L:) immunoglobulin

SCOPe Domain Sequences for d1e6jl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6jl1 b.1.1.1 (L:1-105) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.4 [TaxId: 10090]}
eivltqspaitaaslgqkvtitcsasssvsymhwyqqksgtspkpwiyeisklasgvpar
fsgsgsgtsysltissmeaedaaiyycqqwnypftfgsgtkleik

SCOPe Domain Coordinates for d1e6jl1:

Click to download the PDB-style file with coordinates for d1e6jl1.
(The format of our PDB-style files is described here.)

Timeline for d1e6jl1: