SCOP 1.63: Domain d1e6jl1: 1e6j L:1-105

Lineage for d1e6jl1 (1e6j L:1-105)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain [48909] (2 PDB entries)

8. Domain d1e6jl1: 1e6j L:1-105 [20496]
   Other proteins in same PDB: d1e6jh2, d1e6jl2, d1e6jp1, d1e6jp2

Details for d1e6jl1

PDB Entry: 1e6j, 3 Å

PDB Description: crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5

SCOP Domain Sequences for d1e6jl1:

Sequence; same for both SEQRES and ATOM records:

>d1e6jl1 b.1.1.1 (L:1-105) Immunoglobulin (variable domains of L and H chains) {Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain}
eivltqspaitaaslgqkvtitcsasssvsymhwyqqksgtspkpwiyeisklasgvpar
fsgsgsgtsysltissmeaedaaiyycqqwnypftfgsgtkleik

Timeline for d1e6jl1:

• d1e6jl1 first appeared (with stable ids) in SCOP 1.55
  
• d1e6jl1 appears in SCOP 1.61
  
• d1e6jl1 appears in SCOP 1.65
  
• d1e6jl1 appears in the current release, SCOPe 2.08