![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
![]() | Species Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain [48909] (2 PDB entries) |
![]() | Domain d1e6jl1: 1e6j L:1-105 [20496] Other proteins in same PDB: d1e6jh2, d1e6jl2, d1e6jp1, d1e6jp2 |
PDB Entry: 1e6j (more details), 3 Å
SCOP Domain Sequences for d1e6jl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6jl1 b.1.1.1 (L:1-105) Immunoglobulin (variable domains of L and H chains) {Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain} eivltqspaitaaslgqkvtitcsasssvsymhwyqqksgtspkpwiyeisklasgvpar fsgsgsgtsysltissmeaedaaiyycqqwnypftfgsgtkleik
Timeline for d1e6jl1:
![]() Domains from other chains: (mouse over for more information) d1e6jh1, d1e6jh2, d1e6jp1, d1e6jp2 |