Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (54 species) not a true protein |
Species Pseudomonas fluorescens [TaxId:294] [225188] (3 PDB entries) |
Domain d2j5ie_: 2j5i E: [204946] automated match to d3peaf_ |
PDB Entry: 2j5i (more details), 1.8 Å
SCOPe Domain Sequences for d2j5ie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j5ie_ c.14.1.0 (E:) automated matches {Pseudomonas fluorescens [TaxId: 294]} tyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltga geawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggf splvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqka aemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakl dqsrlldt
Timeline for d2j5ie_: