Lineage for d2j5ie_ (2j5i E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113576Species Pseudomonas fluorescens [TaxId:294] [225188] (3 PDB entries)
  8. 2113581Domain d2j5ie_: 2j5i E: [204946]
    automated match to d3peaf_

Details for d2j5ie_

PDB Entry: 2j5i (more details), 1.8 Å

PDB Description: crystal structure of hydroxycinnamoyl-coa hydratase-lyase
PDB Compounds: (E:) p-hydroxycinnamoyl coa hydratase/lyase

SCOPe Domain Sequences for d2j5ie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5ie_ c.14.1.0 (E:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
tyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltga
geawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggf
splvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqka
aemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakl
dqsrlldt

SCOPe Domain Coordinates for d2j5ie_:

Click to download the PDB-style file with coordinates for d2j5ie_.
(The format of our PDB-style files is described here.)

Timeline for d2j5ie_: