Lineage for d2j5cb1 (2j5c B:87-264)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722844Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 2722845Protein automated matches [226931] (12 species)
    not a true protein
  7. 2722877Species Salvia fruticosa [TaxId:268906] [225284] (1 PDB entry)
  8. 2722879Domain d2j5cb1: 2j5c B:87-264 [204940]
    Other proteins in same PDB: d2j5ca2, d2j5cb2
    automated match to d1n1ba1
    complexed with bme

Details for d2j5cb1

PDB Entry: 2j5c (more details), 1.95 Å

PDB Description: rational conversion of substrate and product specificity in a monoterpene synthase. structural insights into the molecular basis of rapid evolution.
PDB Compounds: (B:) 1,8-cineole synthase

SCOPe Domain Sequences for d2j5cb1:

Sequence, based on SEQRES records: (download)

>d2j5cb1 a.102.4.0 (B:87-264) automated matches {Salvia fruticosa [TaxId: 268906]}
raagmidqvkmmlqeevdsirrleliddlrrlgischfereiveilnskyytnneiderd
lystalrfrllrqydfsvsqevfdcfknakgtdfkpslvddtrgllqlyeasflsaqgee
tlrlardfatkflqkrvlvdkdinllssieralelpthwrvqmpnarsfidaykrrpd

Sequence, based on observed residues (ATOM records): (download)

>d2j5cb1 a.102.4.0 (B:87-264) automated matches {Salvia fruticosa [TaxId: 268906]}
raagmidqvkmmlqeevdsirrleliddlrrlgischfereiveilnskyytnneiderd
lystalrfrllrqydfsvsqevfdcfknakgtdfkpslvddtrgllqlyeasflsaqgee
tlrlardfatkflqkrvlvdinllssieralelpthwrvqmpnarsfidaykrrpd

SCOPe Domain Coordinates for d2j5cb1:

Click to download the PDB-style file with coordinates for d2j5cb1.
(The format of our PDB-style files is described here.)

Timeline for d2j5cb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j5cb2