Lineage for d2j5ca2 (2j5c A:265-591)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2011004Species Salvia fruticosa [TaxId:268906] [225285] (1 PDB entry)
  8. 2011005Domain d2j5ca2: 2j5c A:265-591 [204939]
    Other proteins in same PDB: d2j5ca1, d2j5cb1
    automated match to d1n1ba2
    complexed with bme

Details for d2j5ca2

PDB Entry: 2j5c (more details), 1.95 Å

PDB Description: rational conversion of substrate and product specificity in a monoterpene synthase. structural insights into the molecular basis of rapid evolution.
PDB Compounds: (A:) 1,8-cineole synthase

SCOPe Domain Sequences for d2j5ca2:

Sequence, based on SEQRES records: (download)

>d2j5ca2 a.128.1.0 (A:265-591) automated matches {Salvia fruticosa [TaxId: 268906]}
mnptvlelakldfnmvqaqfqqelkeasrwwnstglvhelpfvrdrivecyywttgvver
rqhgyerimltkinalvttiddvfdiygtleelqlfttaiqrwdiesmkqlppymqicyl
alfnfvnemaydtlrdkgfdstpylrkvwvgliesylieakwyykghkpsleeymknswi
siggipilshlffrltdsieeeaaesmhkyhdivrasctilrladdmgtsldevergdvp
ksvqcymneknaseeearehvrslidqtwkmmnkemmtssfskyfvevsanlarmaqwiy
qhesdgfgmqhslvnkmlrdllfhrye

Sequence, based on observed residues (ATOM records): (download)

>d2j5ca2 a.128.1.0 (A:265-591) automated matches {Salvia fruticosa [TaxId: 268906]}
mnptvlelakldfnmvqaqfqqelkeasrwwnstglvhelprdrivecyywttgvverrq
hgyerimltkinalvttiddvfdiygtleelqlfttaiqrwdiesmkqlppymqicylal
fnfvnemaydtlrdkgfdstpylrkvwvgliesylieakwyykghkpsleeymknswisi
ggipilshlffrltdsieeeaaesmhkyhdivrasctilrladdmgtpksvqcyseeear
ehvrslidqtwkmmnkemmtssfskyfvevsanlarmaqwiyqhesdgfgqhslvnkmlr
dllfhrye

SCOPe Domain Coordinates for d2j5ca2:

Click to download the PDB-style file with coordinates for d2j5ca2.
(The format of our PDB-style files is described here.)

Timeline for d2j5ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j5ca1