Lineage for d2j51a_ (2j51 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983025Protein STE20-like serine/threonine-protein kinase, SLK [160812] (1 species)
  7. 2983026Species Human (Homo sapiens) [TaxId:9606] [160813] (5 PDB entries)
    Uniprot Q9H2G2 21-308
  8. 2983027Domain d2j51a_: 2j51 A: [204937]
    automated match to d2uv2a1
    complexed with dki, edo, scn

Details for d2j51a_

PDB Entry: 2j51 (more details), 2.1 Å

PDB Description: crystal structure of human ste20-like kinase bound to 5-amino-3-((4-(aminosulfonyl)phenyl)amino)-n-(2,6-difluorophenyl)-1h-1,2,4-triazole-1-carbothioamide
PDB Compounds: (A:) ste20-like serine/threonine-protein kinase

SCOPe Domain Sequences for d2j51a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j51a_ d.144.1.7 (A:) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]}
yehvtrdlnpedfweiigelgdgafgkvykaqnketsvlaaakvidtkseeeledymvei
dilascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvckqtl
dalnylhdnkiihrdlkagnilftldgdikladfgvsakntrtiqrrdsfigtpywmape
vvmcetskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptlaqpsr
wssnfkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeak

SCOPe Domain Coordinates for d2j51a_:

Click to download the PDB-style file with coordinates for d2j51a_.
(The format of our PDB-style files is described here.)

Timeline for d2j51a_: