| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein STE20-like serine/threonine-protein kinase, SLK [160812] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [160813] (5 PDB entries) Uniprot Q9H2G2 21-308 |
| Domain d2j51a_: 2j51 A: [204937] automated match to d2uv2a1 complexed with dki, edo, scn |
PDB Entry: 2j51 (more details), 2.1 Å
SCOPe Domain Sequences for d2j51a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j51a_ d.144.1.7 (A:) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]}
yehvtrdlnpedfweiigelgdgafgkvykaqnketsvlaaakvidtkseeeledymvei
dilascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvckqtl
dalnylhdnkiihrdlkagnilftldgdikladfgvsakntrtiqrrdsfigtpywmape
vvmcetskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptlaqpsr
wssnfkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeak
Timeline for d2j51a_: