Lineage for d1qoka2 (1qok A:162-267)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741215Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (43 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 2741232Domain d1qoka2: 1qok A:162-267 [20493]
    Other proteins in same PDB: d1qoka1
    part of anti-carcinoembryonic scFv MFE-23

Details for d1qoka2

PDB Entry: 1qok (more details), 2.4 Å

PDB Description: mfe-23 an anti-carcinoembryonic antigen single-chain fv antibody
PDB Compounds: (A:) mfe-23 recombinant antibody fragment

SCOPe Domain Sequences for d1qoka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qoka2 b.1.1.1 (A:162-267) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
envltqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklwiystsnlasgvpar
fsgsgsgtsysltisrmeaedaatyycqqrssypltfgagtklelk

SCOPe Domain Coordinates for d1qoka2:

Click to download the PDB-style file with coordinates for d1qoka2.
(The format of our PDB-style files is described here.)

Timeline for d1qoka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qoka1