Lineage for d2j1vb_ (2j1v B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304969Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1304970Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1305647Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1305648Protein automated matches [190770] (10 species)
    not a true protein
  7. 1305706Species Streptococcus pneumoniae [TaxId:170187] [193202] (6 PDB entries)
  8. 1305708Domain d2j1vb_: 2j1v B: [204929]
    automated match to d2j1tb_
    complexed with ca, nag

Details for d2j1vb_

PDB Entry: 2j1v (more details), 1.45 Å

PDB Description: structure of a streptococcus pneumoniae fucose binding module in complex with the blood group h-trisaccharide
PDB Compounds: (B:) fucolectin-related protein

SCOPe Domain Sequences for d2j1vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j1vb_ b.18.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
nlniayakpttqssvdyngdpnravdgnrngnfnsgsvthtradnpswwevdlkkmdkvg
lvkiynrtdaetqrlsnfdvilydnnrnevakkhvnnlsgesvsldfkekgaryikvkll
tsgvplslaevevfres

SCOPe Domain Coordinates for d2j1vb_:

Click to download the PDB-style file with coordinates for d2j1vb_.
(The format of our PDB-style files is described here.)

Timeline for d2j1vb_: