| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Streptococcus pneumoniae [TaxId:170187] [193202] (7 PDB entries) |
| Domain d2j1ub_: 2j1u B: [204927] automated match to d2j1tb_ complexed with ca |
PDB Entry: 2j1u (more details), 1.8 Å
SCOPe Domain Sequences for d2j1ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j1ub_ b.18.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
nlniayakpttqssvdyngdpnravdgnrngnfnsgsvthtradnpswwevdlkkmdkvg
lvkiynrtdaetqrlsnfdvilydnnrnevakkhvnnlsgesvsldfkekgaryikvkll
tsgvplslaevevfres
Timeline for d2j1ub_: