![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Streptococcus pneumoniae [TaxId:170187] [193202] (7 PDB entries) |
![]() | Domain d2j1sa_: 2j1s A: [204924] automated match to d2j1tb_ complexed with ca, ful |
PDB Entry: 2j1s (more details), 1.5 Å
SCOPe Domain Sequences for d2j1sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j1sa_ b.18.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]} kfndgnlniayakpttqssvdyngdpnravdgnrngnfnsgsvthtradnpswwevdlkk mdkvglvkiynrtdaetqrlsnfdvilydnnrnevakkhvnnlsgesvsldfkekgaryi kvklltsgvplslaevevfres
Timeline for d2j1sa_: