Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (37 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:170187] [193202] (6 PDB entries) |
Domain d2j1rb_: 2j1r B: [204923] automated match to d2j1tb_ complexed with ca |
PDB Entry: 2j1r (more details), 1.54 Å
SCOPe Domain Sequences for d2j1rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j1rb_ b.18.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]} nlniayakpttqssvdyngdpnravdgnrngnfnsgsvthtradnpswwevdlkkmdkvg lvkiynrtdaetqrlsnfdvilydnnrnevakkhvnnlsgesvsldfkekgaryikvkll tsgvplslaevevfres
Timeline for d2j1rb_: