Lineage for d2j1rb_ (2j1r B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775429Species Streptococcus pneumoniae [TaxId:170187] [193202] (7 PDB entries)
  8. 2775431Domain d2j1rb_: 2j1r B: [204923]
    automated match to d2j1tb_
    complexed with ca

Details for d2j1rb_

PDB Entry: 2j1r (more details), 1.54 Å

PDB Description: structure of a streptococcus pneumoniae fucose binding module
PDB Compounds: (B:) fucolectin-related protein

SCOPe Domain Sequences for d2j1rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j1rb_ b.18.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
nlniayakpttqssvdyngdpnravdgnrngnfnsgsvthtradnpswwevdlkkmdkvg
lvkiynrtdaetqrlsnfdvilydnnrnevakkhvnnlsgesvsldfkekgaryikvkll
tsgvplslaevevfres

SCOPe Domain Coordinates for d2j1rb_:

Click to download the PDB-style file with coordinates for d2j1rb_.
(The format of our PDB-style files is described here.)

Timeline for d2j1rb_: