SCOPe 2.03: Domain d2j1la_: 2j1l A:

Lineage for d2j1la_ (2j1l A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (58 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (75 PDB entries)

8. Domain d2j1la_: 2j1l A: [204921]
   automated match to d1ryhb_
   complexed with gdp, mg

Details for d2j1la_

PDB Entry: 2j1l, 2.5 Å

PDB Description: crystal structure of human rho-related gtp-binding protein rhod

PDB Compounds: (A:) rho-related GTP-binding protein rhod

SCOPe Domain Sequences for d2j1la_:

Sequence, based on SEQRES records:

>d2j1la_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrsvkvvlvgdggcgktsllmvfadgafpesytptvferymvnlqvkgkpvhlhiwdtag
qddydrlrplfypdasvlllcfdvtspnsfdnifnrwypevnhfckkvpiivvgcktdlr
kdkslvnklrrnglepvtyhrgqemarsvgavaylecsarlhdnvhavfqeaaevalss

Sequence, based on observed residues (ATOM records):

>d2j1la_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrsvkvvlvgdggcgktsllmvfadtptvferymvnlqvkgkpvhlhiwdtdasvlllcf
dvtspnsfdnifnrwypevnhfckkvpiivvgcktdlrkdkslvnklrrnglepvtyhrg
qemarsvgavaylecsarlhdnvhavfqeaaevalss

Timeline for d2j1la_:

• d2j1la_ is new in SCOPe 2.03-stable
  
• d2j1la_ appears in SCOPe 2.04
  
• d2j1la_ appears in the current release, SCOPe 2.08