Lineage for d1qoka1 (1qok A:27-147)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) 
Species Anti-carcinoembryonic scFv MFE-23, (mouse), kappa L chain [48908] (1 PDB entry) 
Domain d1qoka1: 1qok A:27-147 [20492]
Details for d1qoka1
PDB Entry: 1qok (more details), 2.4 Å
PDB Description: mfe-23 an anti-carcinoembryonic antigen single-chain fv antibody
SCOP Domain Sequences for d1qoka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qoka1 b.1.1.1 (A:27-147) Immunoglobulin (variable domains of L and H chains) {Anti-carcinoembryonic scFv MFE-23, (mouse), kappa L chain}
qvklqqsgaelvrsgtsvklsctasgfnikdsymhwlrqgpeqglewigwidpengdtey
apkfqgkatfttdtssntaylqlssltsedtavyycnegtptgpyyfdywgqgttvtvss
g
SCOP Domain Coordinates for d1qoka1:
Click to download the PDB-style file with coordinates for d1qoka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qoka1:
- d1qoka1 appears in SCOP 1.57
- d1qoka1 appears in the current release, SCOPe 2.08
View in 3D
