Lineage for d2j0vc_ (2j0v C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872977Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (8 PDB entries)
  8. 2872980Domain d2j0vc_: 2j0v C: [204919]
    Other proteins in same PDB: d2j0va2, d2j0vb2, d2j0vd2
    automated match to d2atxb_
    complexed with gdp, mg

Details for d2j0vc_

PDB Entry: 2j0v (more details), 1.78 Å

PDB Description: the crystal structure of arabidopsis thaliana rac7-rop9: the first ras superfamily gtpase from the plant kingdom
PDB Compounds: (C:) rac-like GTP-binding protein arac7

SCOPe Domain Sequences for d2j0vc_:

Sequence, based on SEQRES records: (download)

>d2j0vc_ c.37.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kfikcvtvgdgavgktcmlicytsnkfptdyiptvfdnfsanvavdgqivnlglwdtagq
edysrlrplsyrgadifvlafsliskasyenvlkkwmpelrrfapnvpivlvgtkldlrd
dkgyladhtnvitstqgeelrkqigaaayiecssktqqnvkavfdtaikvvlq

Sequence, based on observed residues (ATOM records): (download)

>d2j0vc_ c.37.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kfikcvtvgdgavgktcmlicytsnkfptdyiptvfdnfsanvavnlglwdtaglsyrga
difvlafsliskasyenvlkkwmpelrrfapnvpivlvgtkldlrddkgyladhtnvits
tqgeelrkqigaaayiecssktqqnvkavfdtaikvvlq

SCOPe Domain Coordinates for d2j0vc_:

Click to download the PDB-style file with coordinates for d2j0vc_.
(The format of our PDB-style files is described here.)

Timeline for d2j0vc_: