SCOPe 2.05: Domain d2j0vb_: 2j0v B:

Lineage for d2j0vb_ (2j0v B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (5 PDB entries)

8. Domain d2j0vb_: 2j0v B: [204918]
   automated match to d2atxb_
   complexed with gdp, mg

Details for d2j0vb_

PDB Entry: 2j0v, 1.78 Å

PDB Description: the crystal structure of arabidopsis thaliana rac7-rop9: the first ras superfamily gtpase from the plant kingdom

PDB Compounds: (B:) rac-like GTP-binding protein arac7

SCOPe Domain Sequences for d2j0vb_:

Sequence; same for both SEQRES and ATOM records:

>d2j0vb_ c.37.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gshmsvskfikcvtvgdgavgktcmlicytsnkfptdyiptvfdnfsanvavdgqivnlg
lwdtagqedysrlrplsyrgadifvlafsliskasyenvlkkwmpelrrfapnvpivlvg
tkldlrddkgyladhtnvitstqgeelrkqigaaayiecssktqqnvkavfdtaikvvlq
pprr

Timeline for d2j0vb_:

• d2j0vb_ first appeared in SCOPe 2.03
  
• d2j0vb_ appears in SCOPe 2.04
  
• d2j0vb_ appears in SCOPe 2.06
  
• d2j0vb_ appears in the current release, SCOPe 2.08, called d2j0vb1