SCOPe 2.08: Domain d2j0va1: 2j0v A:1-178

Lineage for d2j0va1 (2j0v A:1-178)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (8 PDB entries)

8. Domain d2j0va1: 2j0v A:1-178 [204917]
   Other proteins in same PDB: d2j0va2, d2j0vb2, d2j0vd2
   automated match to d2atxb_
   complexed with gdp, mg

Details for d2j0va1

PDB Entry: 2j0v, 1.78 Å

PDB Description: the crystal structure of arabidopsis thaliana rac7-rop9: the first ras superfamily gtpase from the plant kingdom

PDB Compounds: (A:) rac-like GTP-binding protein arac7

SCOPe Domain Sequences for d2j0va1:

Sequence, based on SEQRES records:

>d2j0va1 c.37.1.0 (A:1-178) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
msvskfikcvtvgdgavgktcmlicytsnkfptdyiptvfdnfsanvavdgqivnlglwd
tagqedysrlrplsyrgadifvlafsliskasyenvlkkwmpelrrfapnvpivlvgtkl
dlrddkgyladhtnvitstqgeelrkqigaaayiecssktqqnvkavfdtaikvvlqp

Sequence, based on observed residues (ATOM records):

>d2j0va1 c.37.1.0 (A:1-178) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
msvskfikcvtvgdgavgktcmlicytsnkfptdyiptvfdnfsanvavdgqivnlglwd
tagqedysrplsyrgadifvlafsliskasyenvlkkwmpelrrfapnvpivlvgtkldl
rddkgyladhtnvitstqgeelrkqigaaayiecssktqqnvkavfdtaikvvlqp

Timeline for d2j0va1:

• d2j0va1 first appeared in SCOPe 2.03, called d2j0va_
  
• d2j0va1 was called d2j0va_ in SCOPe 2.07