Lineage for d2j06a1 (2j06 A:281-341)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783437Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)
  8. 2783460Domain d2j06a1: 2j06 A:281-341 [204915]
    Other proteins in same PDB: d2j06a2
    automated match to d2j05b_

Details for d2j06a1

PDB Entry: 2j06 (more details), 1.8 Å

PDB Description: crystal structure of the rasgap sh3 domain at 1.8 angstrom resolution
PDB Compounds: (A:) Ras GTPase-activating protein 1

SCOPe Domain Sequences for d2j06a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j06a1 b.34.2.0 (A:281-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrrvrailpytkvpdtdeisflkgdmfivhneledgwmwvtnlrtdeqglivedlveevg
r

SCOPe Domain Coordinates for d2j06a1:

Click to download the PDB-style file with coordinates for d2j06a1.
(The format of our PDB-style files is described here.)

Timeline for d2j06a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j06a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2j06b_