| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (23 species) not a true protein |
| Species Lactococcus lactis [TaxId:1358] [225211] (4 PDB entries) |
| Domain d2iz1c2: 2iz1 C:178-470 [204911] Other proteins in same PDB: d2iz1a1, d2iz1b1, d2iz1c1 automated match to d1pgja1 complexed with atr, cl, p33, peg, res |
PDB Entry: 2iz1 (more details), 2.3 Å
SCOPe Domain Sequences for d2iz1c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iz1c2 a.100.1.0 (C:178-470) automated matches {Lactococcus lactis [TaxId: 1358]}
gaghyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitk
evlkrkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykde
rvkaskvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygt
iaqiwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqag
tpiptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyt
Timeline for d2iz1c2:
View in 3DDomains from other chains: (mouse over for more information) d2iz1a1, d2iz1a2, d2iz1b1, d2iz1b2 |