SCOPe 2.04: Domain d2iz1c1: 2iz1 C:2-177

Lineage for d2iz1c1 (2iz1 C:2-177)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:1358] [225210] (4 PDB entries)

8. Domain d2iz1c1: 2iz1 C:2-177 [204910]
   Other proteins in same PDB: d2iz1a2, d2iz1b2, d2iz1c2
   automated match to d1pgja2
   complexed with atr, cl, p33, peg, res

Details for d2iz1c1

PDB Entry: 2iz1, 2.3 Å

PDB Description: 6pdh complexed with pex inhibitor synchrotron data

PDB Compounds: (C:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2iz1c1:

Sequence; same for both SEQRES and ATOM records:

>d2iz1c1 c.2.1.0 (C:2-177) automated matches {Lactococcus lactis [TaxId: 1358]}
aqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktleefv
gslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsgin
figtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgan

Timeline for d2iz1c1:

• d2iz1c1 first appeared in SCOPe 2.03
  
• d2iz1c1 appears in SCOPe 2.05
  
• d2iz1c1 appears in the current release, SCOPe 2.08