Lineage for d2iz1b1 (2iz1 B:-1-177)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831510Species Lactococcus lactis [TaxId:1358] [225210] (4 PDB entries)
  8. 1831512Domain d2iz1b1: 2iz1 B:-1-177 [204908]
    Other proteins in same PDB: d2iz1a2, d2iz1b2, d2iz1c2
    automated match to d1pgja2
    complexed with atr, cl, p33, peg, res

Details for d2iz1b1

PDB Entry: 2iz1 (more details), 2.3 Å

PDB Description: 6pdh complexed with pex inhibitor synchrotron data
PDB Compounds: (B:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2iz1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iz1b1 c.2.1.0 (B:-1-177) automated matches {Lactococcus lactis [TaxId: 1358]}
hhmaqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktle
efvgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaelads
ginfigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgan

SCOPe Domain Coordinates for d2iz1b1:

Click to download the PDB-style file with coordinates for d2iz1b1.
(The format of our PDB-style files is described here.)

Timeline for d2iz1b1: