SCOPe 2.03: Domain d2iz1a2: 2iz1 A:178-470

Lineage for d2iz1a2 (2iz1 A:178-470)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (23 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:1358] [225211] (4 PDB entries)

8. Domain d2iz1a2: 2iz1 A:178-470 [204907]
   Other proteins in same PDB: d2iz1a1, d2iz1b1, d2iz1c1
   automated match to d1pgja1
   complexed with atr, cl, p33, peg, res

Details for d2iz1a2

PDB Entry: 2iz1, 2.3 Å

PDB Description: 6pdh complexed with pex inhibitor synchrotron data

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2iz1a2:

Sequence; same for both SEQRES and ATOM records:

>d2iz1a2 a.100.1.0 (A:178-470) automated matches {Lactococcus lactis [TaxId: 1358]}
gaghyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitk
evlkrkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykde
rvkaskvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygt
iaqiwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqag
tpiptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyt

Timeline for d2iz1a2:

• d2iz1a2 is new in SCOPe 2.03-stable
  
• d2iz1a2 appears in SCOPe 2.04
  
• d2iz1a2 appears in the current release, SCOPe 2.08