Lineage for d2iz1a2 (2iz1 A:178-470)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276308Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1276309Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1276508Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1276509Protein automated matches [226851] (23 species)
    not a true protein
  7. 1276583Species Lactococcus lactis [TaxId:1358] [225211] (4 PDB entries)
  8. 1276584Domain d2iz1a2: 2iz1 A:178-470 [204907]
    Other proteins in same PDB: d2iz1a1, d2iz1b1, d2iz1c1
    automated match to d1pgja1
    complexed with atr, cl, p33, peg, res

Details for d2iz1a2

PDB Entry: 2iz1 (more details), 2.3 Å

PDB Description: 6pdh complexed with pex inhibitor synchrotron data
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2iz1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iz1a2 a.100.1.0 (A:178-470) automated matches {Lactococcus lactis [TaxId: 1358]}
gaghyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitk
evlkrkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykde
rvkaskvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygt
iaqiwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqag
tpiptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyt

SCOPe Domain Coordinates for d2iz1a2:

Click to download the PDB-style file with coordinates for d2iz1a2.
(The format of our PDB-style files is described here.)

Timeline for d2iz1a2: