Lineage for d1dzbb1 (1dzb B:1-117)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103461Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1103878Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
  8. 1103890Domain d1dzbb1: 1dzb B:1-117 [20490]
    Other proteins in same PDB: d1dzba2, d1dzbb2, d1dzbx_, d1dzby_
    part of anti-lysozyme scFv 1F9

Details for d1dzbb1

PDB Entry: 1dzb (more details), 2 Å

PDB Description: crystal structure of phage library-derived single-chain fv fragment 1f9 in complex with turkey egg-white lysozyme
PDB Compounds: (B:) scfv fragment 1f9

SCOPe Domain Sequences for d1dzbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzbb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
qvklqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
dpkfqgkatitadtssntaylqlssltsedtavyycarwdwyfdvwgqgttvtvssg

SCOPe Domain Coordinates for d1dzbb1:

Click to download the PDB-style file with coordinates for d1dzbb1.
(The format of our PDB-style files is described here.)

Timeline for d1dzbb1: