SCOP 1.63: Domain d1dzbb1: 1dzb B:1-117

Lineage for d1dzbb1 (1dzb B:1-117)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-lysozyme scFv 1F9, (mouse), kappa L chain [48907] (1 PDB entry)

8. Domain d1dzbb1: 1dzb B:1-117 [20490]
   Other proteins in same PDB: d1dzbx_, d1dzby_

Details for d1dzbb1

PDB Entry: 1dzb, 2 Å

PDB Description: crystal structure of phage library-derived single-chain fv fragment 1f9 in complex with turkey egg-white lysozyme

SCOP Domain Sequences for d1dzbb1:

Sequence; same for both SEQRES and ATOM records:

>d1dzbb1 b.1.1.1 (B:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-lysozyme scFv 1F9, (mouse), kappa L chain}
qvklqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
dpkfqgkatitadtssntaylqlssltsedtavyycarwdwyfdvwgqgttvtvssg

Timeline for d1dzbb1:

• d1dzbb1 first appeared (with stable ids) in SCOP 1.55
  
• d1dzbb1 appears in SCOP 1.61
  
• d1dzbb1 appears in SCOP 1.65
  
• d1dzbb1 appears in the current release, SCOPe 2.08