Lineage for d1dzbb1 (1dzb B:1-117)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102131Species Anti-lysozyme scFv 1F9, (mouse), kappa L chain [48907] (1 PDB entry)
  8. 102134Domain d1dzbb1: 1dzb B:1-117 [20490]
    Other proteins in same PDB: d1dzbx_, d1dzby_

Details for d1dzbb1

PDB Entry: 1dzb (more details), 2 Å

PDB Description: crystal structure of phage library-derived single-chain fv fragment 1f9 in complex with turkey egg-white lysozyme

SCOP Domain Sequences for d1dzbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzbb1 b.1.1.1 (B:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-lysozyme scFv 1F9, (mouse), kappa L chain}
qvklqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
dpkfqgkatitadtssntaylqlssltsedtavyycarwdwyfdvwgqgttvtvssg

SCOP Domain Coordinates for d1dzbb1:

Click to download the PDB-style file with coordinates for d1dzbb1.
(The format of our PDB-style files is described here.)

Timeline for d1dzbb1: