Lineage for d2iypa2 (2iyp A:178-470)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721773Species Lactococcus lactis [TaxId:1358] [225211] (4 PDB entries)
  8. 2721780Domain d2iypa2: 2iyp A:178-470 [204895]
    Other proteins in same PDB: d2iypa1, d2iypb1, d2iypc1
    automated match to d1pgja1
    complexed with 5rp, a2p, nap

Details for d2iypa2

PDB Entry: 2iyp (more details), 2.79 Å

PDB Description: product rup
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2iypa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iypa2 a.100.1.0 (A:178-470) automated matches {Lactococcus lactis [TaxId: 1358]}
gaghyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitk
evlkrkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykde
rvkaskvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygt
iaqiwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqag
tpiptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyt

SCOPe Domain Coordinates for d2iypa2:

Click to download the PDB-style file with coordinates for d2iypa2.
(The format of our PDB-style files is described here.)

Timeline for d2iypa2: