Lineage for d2iyoa2 (2iyo A:178-470)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742411Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1742412Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1742617Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1742618Protein automated matches [226851] (30 species)
    not a true protein
  7. 1742745Species Lactococcus lactis [TaxId:1358] [225211] (4 PDB entries)
  8. 1742752Domain d2iyoa2: 2iyo A:178-470 [204893]
    Other proteins in same PDB: d2iyoa1
    automated match to d1pgja1
    complexed with 6pg, cac

Details for d2iyoa2

PDB Entry: 2iyo (more details), 2.4 Å

PDB Description: structural characterization of a bacterial 6pdh reveals aspects of specificity, mechanism and mode of inhibition
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2iyoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iyoa2 a.100.1.0 (A:178-470) automated matches {Lactococcus lactis [TaxId: 1358]}
gaghyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitk
evlkrkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykde
rvkaskvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygt
iaqiwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqag
tpiptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyt

SCOPe Domain Coordinates for d2iyoa2:

Click to download the PDB-style file with coordinates for d2iyoa2.
(The format of our PDB-style files is described here.)

Timeline for d2iyoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iyoa1