SCOPe 2.08: Domain d2ix2c1: 2ix2 C:10-141

Lineage for d2ix2c1 (2ix2 C:10-141)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [225132] (4 PDB entries)

8. Domain d2ix2c1: 2ix2 C:10-141 [204890]
   automated match to d1ud9a1

Details for d2ix2c1

PDB Entry: 2ix2, 2.2 Å

PDB Description: crystal structure of the heterotrimeric pcna from sulfolobus solfataricus

PDB Compounds: (C:) DNA polymerase sliding clamp A

SCOPe Domain Sequences for d2ix2c1:

Sequence; same for both SEQRES and ATOM records:

>d2ix2c1 d.131.1.0 (C:10-141) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
nirlinmkvvyddvrvlkdiiqalarlvdeavlkfkqdsvelvaldrahislisvnlpre
mfkeydvndefkfgfntqylmkilkvakrkeaieiasespdsviiniigstnrefnvrnl
evseqeipeinl

Timeline for d2ix2c1:

• d2ix2c1 first appeared in SCOPe 2.03
  
• d2ix2c1 appears in SCOPe 2.07