Lineage for d2iwzb2 (2iwz B:297-459)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881785Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1881786Protein automated matches [196909] (52 species)
    not a true protein
  7. 1882034Species Human (Homo sapiens) [TaxId:9606] [224964] (6 PDB entries)
  8. 1882040Domain d2iwzb2: 2iwz B:297-459 [204887]
    automated match to d1j3na2
    complexed with 6na, nh4

Details for d2iwzb2

PDB Entry: 2iwz (more details), 1.65 Å

PDB Description: human mitochondrial beta-ketoacyl acp synthase complexed with hexanoic acid
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d2iwzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iwzb2 c.95.1.0 (B:297-459) automated matches {Human (Homo sapiens) [TaxId: 9606]}
riyaevlgyglsgdaghitapdpegegalrcmaaalkdagvqpeeisyinahatstplgd
aaenkaikhlfkdhayalavsstkgatghllgaagaveaafttlacyyqklpptlnldcs
epefdlnyvplkaqewktekrfigltnsfgfggtnatlciagl

SCOPe Domain Coordinates for d2iwzb2:

Click to download the PDB-style file with coordinates for d2iwzb2.
(The format of our PDB-style files is described here.)

Timeline for d2iwzb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iwzb1