| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
| Protein automated matches [196909] (83 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224964] (6 PDB entries) |
| Domain d2iwzb2: 2iwz B:297-459 [204887] Other proteins in same PDB: d2iwza3, d2iwzb3 automated match to d1j3na2 complexed with 6na, nh4 |
PDB Entry: 2iwz (more details), 1.65 Å
SCOPe Domain Sequences for d2iwzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iwzb2 c.95.1.0 (B:297-459) automated matches {Human (Homo sapiens) [TaxId: 9606]}
riyaevlgyglsgdaghitapdpegegalrcmaaalkdagvqpeeisyinahatstplgd
aaenkaikhlfkdhayalavsstkgatghllgaagaveaafttlacyyqklpptlnldcs
epefdlnyvplkaqewktekrfigltnsfgfggtnatlciagl
Timeline for d2iwzb2: