SCOPe 2.08: Domain d2iwyb2: 2iwy B:297-459

Lineage for d2iwyb2 (2iwy B:297-459)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224964] (6 PDB entries)

8. Domain d2iwyb2: 2iwy B:297-459 [204883]
   Other proteins in same PDB: d2iwya3, d2iwyb3
   automated match to d1j3na2
   complexed with nh4

Details for d2iwyb2

PDB Entry: 2iwy, 2.06 Å

PDB Description: human mitochondrial beta-ketoacyl acp synthase

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d2iwyb2:

Sequence; same for both SEQRES and ATOM records:

>d2iwyb2 c.95.1.0 (B:297-459) automated matches {Human (Homo sapiens) [TaxId: 9606]}
riyaevlgyglsgdaghitapdpegegalrcmaaalkdagvqpeeisyinahatstplgd
aaenkaikhlfkdhayalavsstkgatghllgaagaveaafttlacyyqklpptlnldcs
epefdlnyvplkaqewktekrfigltnsfgfggtnatlciagl

Timeline for d2iwyb2:

• d2iwyb2 first appeared in SCOPe 2.03
  
• d2iwyb2 appears in SCOPe 2.07