Lineage for d2iwyb1 (2iwy B:38-296)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488301Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2488302Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2489065Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2489066Protein automated matches [196909] (63 species)
    not a true protein
  7. 2489369Species Human (Homo sapiens) [TaxId:9606] [224964] (6 PDB entries)
  8. 2489380Domain d2iwyb1: 2iwy B:38-296 [204882]
    Other proteins in same PDB: d2iwya3, d2iwyb3
    automated match to d1j3na1
    complexed with nh4

Details for d2iwyb1

PDB Entry: 2iwy (more details), 2.06 Å

PDB Description: human mitochondrial beta-ketoacyl acp synthase
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d2iwyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iwyb1 c.95.1.0 (B:38-296) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srlhrrvvitgiglvtplgvgthlvwdrliggesgivslvgeeyksipcsvaayvprgsd
egqfneqnfvsksdiksmssptimaigaaelamkdsgwhpqseadqvatgvaigmgmipl
evvsetalnfqtkgynkvspffvpkilvnmaagqvsiryklkgpnhavstacttgahavg
dsfrfiahgdadvmvaggtdscisplslagfsraralstnsdpklacrpfhpkrdgfvmg
egaavlvleeyehavqrra

SCOPe Domain Coordinates for d2iwyb1:

Click to download the PDB-style file with coordinates for d2iwyb1.
(The format of our PDB-style files is described here.)

Timeline for d2iwyb1: