Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Anti-lysozyme scFv 1F9, (mouse), kappa L chain [48907] (1 PDB entry) |
Domain d1dzba1: 1dzb A:1-117 [20488] Other proteins in same PDB: d1dzbx_, d1dzby_ |
PDB Entry: 1dzb (more details), 2 Å
SCOP Domain Sequences for d1dzba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dzba1 b.1.1.1 (A:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-lysozyme scFv 1F9, (mouse), kappa L chain} qvklqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky dpkfqgkatitadtssntaylqlssltsedtavyycarwdwyfdvwgqgttvtvssg
Timeline for d1dzba1:
View in 3D Domains from other chains: (mouse over for more information) d1dzbb1, d1dzbb2, d1dzbx_, d1dzby_ |