Lineage for d1dzba1 (1dzb A:1-117)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7136Species Anti-lysozyme scFv 1F9, (mouse), kappa L chain [48907] (1 PDB entry)
  8. 7137Domain d1dzba1: 1dzb A:1-117 [20488]
    Other proteins in same PDB: d1dzbx_, d1dzby_

Details for d1dzba1

PDB Entry: 1dzb (more details), 2 Å

PDB Description: crystal structure of phage library-derived single-chain fv fragment 1f9 in complex with turkey egg-white lysozyme

SCOP Domain Sequences for d1dzba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzba1 b.1.1.1 (A:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-lysozyme scFv 1F9, (mouse), kappa L chain}
qvklqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
dpkfqgkatitadtssntaylqlssltsedtavyycarwdwyfdvwgqgttvtvssg

SCOP Domain Coordinates for d1dzba1:

Click to download the PDB-style file with coordinates for d1dzba1.
(The format of our PDB-style files is described here.)

Timeline for d1dzba1: