SCOPe 2.06: Domain d2iwqa1: 2iwq A:1148-1247

Lineage for d2iwqa1 (2iwq A:1148-1247)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (40 PDB entries)

8. Domain d2iwqa1: 2iwq A:1148-1247 [204879]
   Other proteins in same PDB: d2iwqa2
   automated match to d2fcfa1

Details for d2iwqa1

PDB Entry: 2iwq, 1.8 Å

PDB Description: 7th pdz domain of multiple pdz domain protein mpdz

PDB Compounds: (A:) Multiple PDZ domain protein

SCOPe Domain Sequences for d2iwqa1:

Sequence, based on SEQRES records:

>d2iwqa1 b.36.1.1 (A:1148-1247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qprrvelwrepskslgisivggrgmgsrlsngevmrgifikhvledspagkngtlkpgdr
ivevdgmdlrdasheqaveairkagnpvvfmvqsiistrl

Sequence, based on observed residues (ATOM records):

>d2iwqa1 b.36.1.1 (A:1148-1247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qprrvelwrepskslgisivggrevmrgifikhvledspagkngtlkpgdrivevdgmdl
rdasheqaveairkagnpvvfmvqsiistrl

Timeline for d2iwqa1:

• d2iwqa1 first appeared in SCOPe 2.03, called d2iwqa_
  
• d2iwqa1 was called d2iwqa_ in SCOPe 2.05
  
• d2iwqa1 appears in SCOPe 2.07
  
• d2iwqa1 appears in the current release, SCOPe 2.08