Lineage for d2iwkb2 (2iwk B:467-597)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772203Species Achromobacter cycloclastes [TaxId:223] [225121] (13 PDB entries)
  8. 2772206Domain d2iwkb2: 2iwk B:467-597 [204874]
    Other proteins in same PDB: d2iwka1, d2iwkb1
    automated match to d1fwxa1
    complexed with ca, cl, cu, cuz, iod, na

Details for d2iwkb2

PDB Entry: 2iwk (more details), 1.7 Å

PDB Description: inhibitor-bound form of nitrous oxide reductase from achromobacter cycloclastes at 1.7 angstrom resolution
PDB Compounds: (B:) nitrous oxide reductase

SCOPe Domain Sequences for d2iwkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iwkb2 b.6.1.0 (B:467-597) automated matches {Achromobacter cycloclastes [TaxId: 223]}
svwdrndplwaetrkqaeadevdidewteavirdgnkvrvymtsvapsfsqpsftvkegd
evtvivtnldeiddlthgftmgnhgvamevgpqqtssvtfvaanpgvywyycqwfchalh
memrgrmfvep

SCOPe Domain Coordinates for d2iwkb2:

Click to download the PDB-style file with coordinates for d2iwkb2.
(The format of our PDB-style files is described here.)

Timeline for d2iwkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iwkb1