Lineage for d2iwkb1 (2iwk B:8-466)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065931Superfamily b.69.3: Nitrous oxide reductase, N-terminal domain [50974] (1 family) (S)
  5. 2065932Family b.69.3.1: Nitrous oxide reductase, N-terminal domain [50975] (2 protein domains)
  6. 2065946Protein automated matches [226900] (3 species)
    not a true protein
  7. 2065947Species Achromobacter cycloclastes [TaxId:223] [225120] (2 PDB entries)
  8. 2065949Domain d2iwkb1: 2iwk B:8-466 [204873]
    Other proteins in same PDB: d2iwka2, d2iwkb2
    automated match to d1fwxa2
    complexed with ca, cl, cu, cuz, iod, na

Details for d2iwkb1

PDB Entry: 2iwk (more details), 1.7 Å

PDB Description: inhibitor-bound form of nitrous oxide reductase from achromobacter cycloclastes at 1.7 angstrom resolution
PDB Compounds: (B:) nitrous oxide reductase

SCOPe Domain Sequences for d2iwkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iwkb1 b.69.3.1 (B:8-466) automated matches {Achromobacter cycloclastes [TaxId: 223]}
adgsvapgklddyygfwssgqtgemrilgipsmrelmrvpvfnrcsatgwgqtnesirih
qrtmtektkkqlaangkkihdngdlhhvhmsftdgkydgrylfmndkantrvarvrcdvm
ktdaileipnakgihgmrpqkwprsnyvfcngedeaplvndgstmtdvatyvniftavda
dkwevawqvkvsgnldncdadyegkwafstsynsemgmtleemtksemdhvvvfniaeie
kaikagqyeeingvkvvdgrkeakslftryipiannphgcnmapdrkhlcvagklsptvt
vldvtkfdalfydnaeprsavvaepelglgplhtafdgrgnaytslfldsqvvkwnidea
irayagekinpikdkldvqyqpghlktvmgetldaandwlvclckfskdrflnvgplkpe
ndqlidisgdkmvlvhdgptfaephdaiavspsilpnir

SCOPe Domain Coordinates for d2iwkb1:

Click to download the PDB-style file with coordinates for d2iwkb1.
(The format of our PDB-style files is described here.)

Timeline for d2iwkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iwkb2