Lineage for d1fl3b1 (1fl3 B:2-113)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219281Species Blue fluorescent Fab 19G2, (mouse), kappa L chain [48906] (1 PDB entry)
  8. 219283Domain d1fl3b1: 1fl3 B:2-113 [20487]
    Other proteins in same PDB: d1fl3a2, d1fl3b2, d1fl3h2, d1fl3l2
    complexed with spb

Details for d1fl3b1

PDB Entry: 1fl3 (more details), 2.45 Å

PDB Description: crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k

SCOP Domain Sequences for d1fl3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl3b1 b.1.1.1 (B:2-113) Immunoglobulin (variable domains of L and H chains) {Blue fluorescent Fab 19G2, (mouse), kappa L chain}
aaltqspvsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnlas
gvpnrfsssgsgtdftlrintveaedvgvyycaqnlelpptfgagtklelkr

SCOP Domain Coordinates for d1fl3b1:

Click to download the PDB-style file with coordinates for d1fl3b1.
(The format of our PDB-style files is described here.)

Timeline for d1fl3b1: