SCOP 1.61: Domain d1fl3b1: 1fl3 B:2-113

Lineage for d1fl3b1 (1fl3 B:2-113)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Blue fluorescent Fab 19G2, (mouse), kappa L chain [48906] (1 PDB entry)

8. Domain d1fl3b1: 1fl3 B:2-113 [20487]
   Other proteins in same PDB: d1fl3a2, d1fl3b2, d1fl3h2, d1fl3l2

Details for d1fl3b1

PDB Entry: 1fl3, 2.45 Å

PDB Description: crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k

SCOP Domain Sequences for d1fl3b1:

Sequence; same for both SEQRES and ATOM records:

>d1fl3b1 b.1.1.1 (B:2-113) Immunoglobulin (variable domains of L and H chains) {Blue fluorescent Fab 19G2, (mouse), kappa L chain}
aaltqspvsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnlas
gvpnrfsssgsgtdftlrintveaedvgvyycaqnlelpptfgagtklelkr

Timeline for d1fl3b1:

• d1fl3b1 first appeared (with stable ids) in SCOP 1.55
  
• d1fl3b1 appears in SCOP 1.59
  
• d1fl3b1 appears in SCOP 1.63
  
• d1fl3b1 appears in the current release, SCOPe 2.08